PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DL_FCDEB9A8B.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 242aa    MW: 26560.6 Da    PI: 4.9853
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DL_FCDEB9A8B.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.11.3e-151461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT eEd  lv  ++q+G  +W + ++  g+ R++k+c++rw +yl
  Traes_6DL_FCDEB9A8B.1 14 RGPWTVEEDMTLVAHIEQHGHSNWGALPKQAGLLRCAKSCRLRWINYL 61
                           89******************************99************97 PP

2Myb_DNA-binding54.42.9e-1767112148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++T eE++ +++++++lG++ W+tIa++++ gRt++++k+ w+++l
  Traes_6DL_FCDEB9A8B.1  67 RGNFTSEEEDAIIQLHAMLGNR-WSTIAARLP-GRTDNEIKNVWHTHL 112
                            89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-22564IPR009057Homeodomain-like
PROSITE profilePS5129412.138961IPR017930Myb domain
SuperFamilySSF466899.54E-3011108IPR009057Homeodomain-like
SMARTSM007171.8E-101363IPR001005SANT/Myb domain
PfamPF002491.4E-131461IPR001005SANT/Myb domain
CDDcd001671.57E-101661No hitNo description
PROSITE profilePS5129424.49762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-2665116IPR009057Homeodomain-like
SMARTSM007171.4E-1466114IPR001005SANT/Myb domain
PfamPF002492.2E-1567112IPR001005SANT/Myb domain
CDDcd001673.95E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MVRAPCCEKT GLKRGPWTVE EDMTLVAHIE QHGHSNWGAL PKQAGLLRCA KSCRLRWINY  60
LCPDIKRGNF TSEEEDAIIQ LHAMLGNRWS TIAARLPGRT DNEIKNVWHT HLKKRLDSSL  120
SKTSGQAAPK RKAKKPDVAA STLEDPTSDP VSPEQSLSTS SATDYSMASS LENTGSSSDE  180
FQIDDSFWSE TLAMSVDCSG SGMETSDTVA ADSASPSSSN DEMDFWVTLF MQDGDMHSLS  240
QI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26121185110B-MYB
1h8a_C2e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU0116870.0GU011687.1 Leymus multicaulis MYB1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575391.11e-131PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH44e-89MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLW5H1390.0W5H139_WHEAT; Uncharacterized protein
STRINGMLOC_34646.11e-147(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.14e-74myb domain protein 15
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]